Lineage for d1xmsa1 (1xms A:3-268)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2477556Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2478035Protein RecA protein, ATPase-domain [52671] (6 species)
    C-terminal domain is alpha+beta
  7. 2478038Species Escherichia coli [TaxId:562] [52672] (7 PDB entries)
    Uniprot P0A7G6 P03017
  8. 2478042Domain d1xmsa1: 1xms A:3-268 [115559]
    Other proteins in same PDB: d1xmsa2
    protein/DNA complex; complexed with anp, mn

Details for d1xmsa1

PDB Entry: 1xms (more details), 2.1 Å

PDB Description: e. coli reca in complex with mnamp-pnp
PDB Compounds: (A:) reca protein

SCOPe Domain Sequences for d1xmsa1:

Sequence, based on SEQRES records: (download)

>d1xmsa1 c.37.1.11 (A:3-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}
denkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriv
eiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtg
eqaleicdalarsgavdvivvdsvaaltpkaeiegeigdshmglaarmmsqamrklagnl
kqsntllifinqirmkigvmfgnpetttggnalkfyasvrldirrigavkegenvvgset
rvkvvknkiaapfkqaefqilygegi

Sequence, based on observed residues (ATOM records): (download)

>d1xmsa1 c.37.1.11 (A:3-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}
denkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriv
eiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtg
eqaleicdalarsgavdvivvdsvaaltpkaeieaarmmsqamrklagnlkqsntllifi
nqignalkfyasvrldirrigavkegenvvgsetrvkvvknkiaapfkqaefqilygegi

SCOPe Domain Coordinates for d1xmsa1:

Click to download the PDB-style file with coordinates for d1xmsa1.
(The format of our PDB-style files is described here.)

Timeline for d1xmsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xmsa2