Lineage for d1xmqt_ (1xmq T:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534473Fold a.7: Spectrin repeat-like [46965] (13 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 534573Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 534574Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
  6. 534575Protein Ribosomal protein S20 [46994] (1 species)
  7. 534576Species Thermus thermophilus [TaxId:274] [46995] (18 PDB entries)
  8. 534579Domain d1xmqt_: 1xmq T: [115549]
    Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqv_
    complexed with mg, par, t6a, zn

Details for d1xmqt_

PDB Entry: 1xmq (more details), 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center

SCOP Domain Sequences for d1xmqt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmqt_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d1xmqt_:

Click to download the PDB-style file with coordinates for d1xmqt_.
(The format of our PDB-style files is described here.)

Timeline for d1xmqt_: