Lineage for d1xmqr_ (1xmq R:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 534044Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 534045Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 534046Protein Ribosomal protein S18 [46913] (1 species)
  7. 534047Species Thermus thermophilus [TaxId:274] [46914] (19 PDB entries)
  8. 534050Domain d1xmqr_: 1xmq R: [115547]
    Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqs_, d1xmqt_, d1xmqv_
    complexed with mg, par, t6a, zn

Details for d1xmqr_

PDB Entry: 1xmq (more details), 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center

SCOP Domain Sequences for d1xmqr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmqr_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOP Domain Coordinates for d1xmqr_:

Click to download the PDB-style file with coordinates for d1xmqr_.
(The format of our PDB-style files is described here.)

Timeline for d1xmqr_: