| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234 |
Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) ![]() |
| Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
| Protein Ribosomal protein S16 [54567] (3 species) |
| Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries) Uniprot P80379 |
| Domain d1xmqp_: 1xmq P: [115545] Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_ complexed with mg, par, zn |
PDB Entry: 1xmq (more details), 3 Å
SCOPe Domain Sequences for d1xmqp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmqp_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe
Timeline for d1xmqp_: