Lineage for d1xmqp_ (1xmq P:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549131Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 2549132Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 2549133Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 2549134Protein Ribosomal protein S16 [54567] (3 species)
  7. 2549164Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
    Uniprot P80379
  8. 2549167Domain d1xmqp_: 1xmq P: [115545]
    Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_
    complexed with mg, par, zn

Details for d1xmqp_

PDB Entry: 1xmq (more details), 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d1xmqp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmqp_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOPe Domain Coordinates for d1xmqp_:

Click to download the PDB-style file with coordinates for d1xmqp_.
(The format of our PDB-style files is described here.)

Timeline for d1xmqp_: