SCOPe 2.06: Domain d1xmqp_: 1xmq P:

Lineage for d1xmqp_ (1xmq P:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
   beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234

4. Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family)

5. Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)

6. Protein Ribosomal protein S16 [54567] (3 species)

7. Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
   Uniprot P80379

8. Domain d1xmqp_: 1xmq P: [115545]
   Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_
   complexed with mg, par, zn

Details for d1xmqp_

PDB Entry: 1xmq, 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center

PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d1xmqp_:

Sequence; same for both SEQRES and ATOM records:

>d1xmqp_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

Timeline for d1xmqp_:

• d1xmqp_ first appeared in SCOP 1.71
  
• d1xmqp_ appears in SCOPe 2.05
  
• d1xmqp_ appears in SCOPe 2.07
  
• d1xmqp_ appears in the current release, SCOPe 2.08