Lineage for d1xmqp_ (1xmq P:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720771Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 720772Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 720773Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 720774Protein Ribosomal protein S16 [54567] (1 species)
  7. 720775Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
  8. 720794Domain d1xmqp_: 1xmq P: [115545]
    Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_
    complexed with mg, par, t6a, zn

Details for d1xmqp_

PDB Entry: 1xmq (more details), 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center
PDB Compounds: (P:) 30S ribosomal protein S16

SCOP Domain Sequences for d1xmqp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmqp_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOP Domain Coordinates for d1xmqp_:

Click to download the PDB-style file with coordinates for d1xmqp_.
(The format of our PDB-style files is described here.)

Timeline for d1xmqp_: