Lineage for d1xmqo_ (1xmq O:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764625Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 764626Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 764635Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
  6. 764636Protein Ribosomal protein S15 [47065] (3 species)
  7. 764650Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
    Uniprot P80378
  8. 764658Domain d1xmqo_: 1xmq O: [115544]
    Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_
    complexed with mg, par, t6a, zn

Details for d1xmqo_

PDB Entry: 1xmq (more details), 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center
PDB Compounds: (O:) 30S ribosomal protein S15

SCOP Domain Sequences for d1xmqo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmqo_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d1xmqo_:

Click to download the PDB-style file with coordinates for d1xmqo_.
(The format of our PDB-style files is described here.)

Timeline for d1xmqo_: