SCOP 1.71: Domain d1xmqo_: 1xmq O:

Lineage for d1xmqo_ (1xmq O:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families)

5. Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
   contains additional N-terminal helix that forms a separate unit

6. Protein Ribosomal protein S15 [47065] (2 species)

7. Species Thermus thermophilus [TaxId:274] [47067] (23 PDB entries)

8. Domain d1xmqo_: 1xmq O: [115544]
   Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_
   complexed with mg, par, t6a, zn

Details for d1xmqo_

PDB Entry: 1xmq, 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center

SCOP Domain Sequences for d1xmqo_:

Sequence; same for both SEQRES and ATOM records:

>d1xmqo_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

Timeline for d1xmqo_:

• d1xmqo_ is new in SCOP 1.71
  
• d1xmqo_ appears in SCOP 1.73
  
• d1xmqo_ appears in the current release, SCOPe 2.08