SCOP 1.73: Domain d1xmqn_: 1xmq N:

Lineage for d1xmqn_ (1xmq N:)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (1 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (36 PDB entries)

8. Domain d1xmqn_: 1xmq N: [115543]
   Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_
   complexed with mg, par, t6a, zn

Details for d1xmqn_

PDB Entry: 1xmq, 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center

PDB Compounds: (N:) 30S ribosomal protein S14

SCOP Domain Sequences for d1xmqn_:

Sequence; same for both SEQRES and ATOM records:

>d1xmqn_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d1xmqn_:

• d1xmqn_ first appeared in SCOP 1.71
  
• d1xmqn_ appears in SCOP 1.75
  
• d1xmqn_ appears in the current release, SCOPe 2.08