SCOPe 2.07: Domain d1xmql_: 1xmq L:

Lineage for d1xmql_ (1xmq L:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
   barrel, closed; n=5, S=8

6. Protein Ribosomal protein S12 [50302] (2 species)

7. Species Thermus thermophilus [TaxId:274] [50303] (36 PDB entries)
   Uniprot P17293

8. Domain d1xmql_: 1xmq L: [115541]
   Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_
   complexed with mg, par, zn

Details for d1xmql_

PDB Entry: 1xmq, 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center

PDB Compounds: (L:) 30S ribosomal protein S12

SCOPe Domain Sequences for d1xmql_:

Sequence; same for both SEQRES and ATOM records:

>d1xmql_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

Timeline for d1xmql_:

• d1xmql_ first appeared in SCOP 1.71
  
• d1xmql_ appears in SCOPe 2.06
  
• d1xmql_ appears in the current release, SCOPe 2.08