SCOPe 2.07: Domain d1xmqj_: 1xmq J:

Lineage for d1xmqj_ (1xmq J:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family)
   automatically mapped to Pfam PF00338

5. Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)

6. Protein Ribosomal protein S10 [55001] (2 species)

7. Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries)
   Uniprot P80375

8. Domain d1xmqj_: 1xmq J: [115539]
   Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_
   complexed with mg, par, zn

Details for d1xmqj_

PDB Entry: 1xmq, 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center

PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d1xmqj_:

Sequence; same for both SEQRES and ATOM records:

>d1xmqj_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

Timeline for d1xmqj_:

• d1xmqj_ first appeared in SCOP 1.71
  
• d1xmqj_ appears in SCOPe 2.06
  
• d1xmqj_ appears in the current release, SCOPe 2.08