Lineage for d1xmqj_ (1xmq J:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 604427Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 604428Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 604429Protein Ribosomal protein S10 [55001] (1 species)
  7. 604430Species Thermus thermophilus [TaxId:274] [55002] (18 PDB entries)
  8. 604433Domain d1xmqj_: 1xmq J: [115539]
    Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_
    complexed with mg, par, t6a, zn

Details for d1xmqj_

PDB Entry: 1xmq (more details), 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center

SCOP Domain Sequences for d1xmqj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmqj_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOP Domain Coordinates for d1xmqj_:

Click to download the PDB-style file with coordinates for d1xmqj_.
(The format of our PDB-style files is described here.)

Timeline for d1xmqj_: