![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) ![]() automatically mapped to Pfam PF00338 |
![]() | Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) |
![]() | Protein Ribosomal protein S10 [55001] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries) Uniprot P80375 |
![]() | Domain d1xmqj_: 1xmq J: [115539] Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_ complexed with mg, par, zn |
PDB Entry: 1xmq (more details), 3 Å
SCOPe Domain Sequences for d1xmqj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmqj_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]} kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh felrthnrlvdiinpnrktieqlmtldlptgveieikt
Timeline for d1xmqj_: