SCOPe 2.07: Domain d1xmqg_: 1xmq G:

Lineage for d1xmqg_ (1xmq G:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
   core: 5 helices; contains one more helix and a beta-hairpin outside the core

4. Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family)

5. Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)

6. Protein Ribosomal protein S7 [47975] (4 species)

7. Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
   Uniprot P17291

8. Domain d1xmqg_: 1xmq G: [115536]
   Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_
   complexed with mg, par, zn

Details for d1xmqg_

PDB Entry: 1xmq, 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center

PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d1xmqg_:

Sequence; same for both SEQRES and ATOM records:

>d1xmqg_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

Timeline for d1xmqg_:

• d1xmqg_ first appeared in SCOP 1.71
  
• d1xmqg_ appears in SCOPe 2.06
  
• d1xmqg_ appears in the current release, SCOPe 2.08