Lineage for d1xmqg_ (1xmq G:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1274376Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 1274377Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 1274378Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 1274379Protein Ribosomal protein S7 [47975] (4 species)
  7. 1274409Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 1274419Domain d1xmqg_: 1xmq G: [115536]
    Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_
    complexed with mg, par, zn

Details for d1xmqg_

PDB Entry: 1xmq (more details), 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d1xmqg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmqg_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d1xmqg_:

Click to download the PDB-style file with coordinates for d1xmqg_.
(The format of our PDB-style files is described here.)

Timeline for d1xmqg_: