![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) ![]() |
![]() | Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
![]() | Protein Ribosomal protein S6 [54997] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54998] (24 PDB entries) |
![]() | Domain d1xmqf_: 1xmq F: [115535] Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_ complexed with mg, par, t6a, zn |
PDB Entry: 1xmq (more details), 3 Å
SCOP Domain Sequences for d1xmqf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmqf_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus} mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
Timeline for d1xmqf_: