Lineage for d1xmqe2 (1xmq E:5-73)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946839Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2946840Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2946921Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
    automatically mapped to Pfam PF00333
  6. 2946922Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
    lacks the N-terminal helix
  7. 2946950Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries)
    Uniprot P27152
  8. 2946953Domain d1xmqe2: 1xmq E:5-73 [115534]
    Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_
    complexed with mg, par, zn

Details for d1xmqe2

PDB Entry: 1xmq (more details), 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d1xmqe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmqe2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

SCOPe Domain Coordinates for d1xmqe2:

Click to download the PDB-style file with coordinates for d1xmqe2.
(The format of our PDB-style files is described here.)

Timeline for d1xmqe2: