![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) ![]() |
![]() | Family d.14.1.1: Translational machinery components [54212] (4 proteins) |
![]() | Protein Ribosomal protein S5, C-terminal domain [54215] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries) Uniprot P27152 Uniprot P80373 Uniprot P27152 ! Uniprot P80373 |
![]() | Domain d1xmqe1: 1xmq E:74-154 [115533] Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_ complexed with mg, par, t6a, zn |
PDB Entry: 1xmq (more details), 3 Å
SCOP Domain Sequences for d1xmqe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmqe1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]} gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay atmealrqlrtkadverlrkg
Timeline for d1xmqe1: