Lineage for d1xmqd_ (1xmq D:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 605384Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 605385Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 605386Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 605387Protein Ribosomal protein S4 [55179] (2 species)
    also contains a Zn-binding N-terminal subdomain
  7. 605391Species Thermus thermophilus [TaxId:274] [55180] (18 PDB entries)
  8. 605394Domain d1xmqd_: 1xmq D: [115532]
    Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_
    complexed with mg, par, t6a, zn

Details for d1xmqd_

PDB Entry: 1xmq (more details), 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center

SCOP Domain Sequences for d1xmqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmqd_ d.66.1.2 (D:) Ribosomal protein S4 {Thermus thermophilus}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOP Domain Coordinates for d1xmqd_:

Click to download the PDB-style file with coordinates for d1xmqd_.
(The format of our PDB-style files is described here.)

Timeline for d1xmqd_: