Lineage for d1xmqc2 (1xmq C:107-207)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602826Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 602827Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 602828Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 602829Protein Ribosomal protein S3 C-terminal domain [54823] (1 species)
  7. 602830Species Thermus thermophilus [TaxId:274] [54824] (18 PDB entries)
  8. 602833Domain d1xmqc2: 1xmq C:107-207 [115531]
    Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_
    complexed with mg, par, t6a, zn

Details for d1xmqc2

PDB Entry: 1xmq (more details), 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center

SCOP Domain Sequences for d1xmqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmqc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d1xmqc2:

Click to download the PDB-style file with coordinates for d1xmqc2.
(The format of our PDB-style files is described here.)

Timeline for d1xmqc2: