Lineage for d1xmqc1 (1xmq C:2-106)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860188Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 860215Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 860216Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 860229Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)
  7. 860259Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries)
    Uniprot P80372
  8. 860264Domain d1xmqc1: 1xmq C:2-106 [115530]
    Other proteins in same PDB: d1xmqb_, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_
    complexed with mg, par, t6a, zn

Details for d1xmqc1

PDB Entry: 1xmq (more details), 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center
PDB Compounds: (C:) 30S ribosomal protein S3

SCOP Domain Sequences for d1xmqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmqc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

SCOP Domain Coordinates for d1xmqc1:

Click to download the PDB-style file with coordinates for d1xmqc1.
(The format of our PDB-style files is described here.)

Timeline for d1xmqc1: