SCOP 1.71: Domain d1xmqc1: 1xmq C:2-106

Lineage for d1xmqc1 (1xmq C:2-106)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (8 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54817] (18 PDB entries)

8. Domain d1xmqc1: 1xmq C:2-106 [115530]
   Other proteins in same PDB: d1xmqb_, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_
   complexed with mg, par, t6a, zn

Details for d1xmqc1

PDB Entry: 1xmq, 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center

SCOP Domain Sequences for d1xmqc1:

Sequence; same for both SEQRES and ATOM records:

>d1xmqc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

Timeline for d1xmqc1:

• d1xmqc1 is new in SCOP 1.71
  
• d1xmqc1 appears in SCOP 1.73
  
• d1xmqc1 appears in the current release, SCOPe 2.08