SCOP 1.75: Domain d1xmpe_: 1xmp E:

Lineage for d1xmpe_ (1xmp E:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (1 family)

5. Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (1 protein)

6. Protein N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52257] (4 species)

7. Species Bacillus anthracis [TaxId:1392] [117479] (1 PDB entry)
   Uniprot Q81ZH8

8. Domain d1xmpe_: 1xmp E: [115525]

Details for d1xmpe_

PDB Entry: 1xmp, 1.8 Å

PDB Description: Crystal Structure of PurE (BA0288) from Bacillus anthracis at 1.8 Resolution

PDB Compounds: (E:) phosphoribosylaminoimidazole carboxylase

SCOP Domain Sequences for d1xmpe_:

Sequence; same for both SEQRES and ATOM records:

>d1xmpe_ c.23.8.1 (E:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]}
kslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyaetarerglkvi
iagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpvatvaigkags
tnagllaaqilgsfhddihdalelrreaiekdvre

Timeline for d1xmpe_:

• d1xmpe_ first appeared in SCOP 1.71
  
• d1xmpe_ appears in SCOP 1.73
  
• d1xmpe_ appears in SCOPe 2.01
  
• d1xmpe_ appears in the current release, SCOPe 2.08