Lineage for d1xmpc_ (1xmp C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1839075Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 1839076Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 protein domains)
    automatically mapped to Pfam PF00731
  6. 1839077Protein N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52257] (4 species)
  7. 1839101Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [117479] (1 PDB entry)
    Uniprot Q81ZH8
  8. 1839104Domain d1xmpc_: 1xmp C: [115523]

Details for d1xmpc_

PDB Entry: 1xmp (more details), 1.8 Å

PDB Description: Crystal Structure of PurE (BA0288) from Bacillus anthracis at 1.8 Resolution
PDB Compounds: (C:) phosphoribosylaminoimidazole carboxylase

SCOPe Domain Sequences for d1xmpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmpc_ c.23.8.1 (C:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
sshhhhhhmkslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyaet
arerglkviiagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpva
tvaigkagstnagllaaqilgsfhddihdalelrreaiekdvre

SCOPe Domain Coordinates for d1xmpc_:

Click to download the PDB-style file with coordinates for d1xmpc_.
(The format of our PDB-style files is described here.)

Timeline for d1xmpc_: