Class a: All alpha proteins [46456] (258 folds) |
Fold a.7: Spectrin repeat-like [46965] (15 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) |
Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain |
Protein Ribosomal protein S20 [46994] (1 species) |
Species Thermus thermophilus [TaxId:274] [46995] (36 PDB entries) |
Domain d1xmot_: 1xmo T: [115519] Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmov_ complexed with mg, mnu, par, t6a, zn |
PDB Entry: 1xmo (more details), 3.25 Å
SCOP Domain Sequences for d1xmot_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmot_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]} rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
Timeline for d1xmot_: