Lineage for d1xmot_ (1xmo T:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636659Fold a.7: Spectrin repeat-like [46965] (15 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 636765Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 636766Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 636767Protein Ribosomal protein S20 [46994] (1 species)
  7. 636768Species Thermus thermophilus [TaxId:274] [46995] (36 PDB entries)
  8. 636781Domain d1xmot_: 1xmo T: [115519]
    Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmov_
    complexed with mg, mnu, par, t6a, zn

Details for d1xmot_

PDB Entry: 1xmo (more details), 3.25 Å

PDB Description: Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center
PDB Compounds: (T:) 30S ribosomal protein S20

SCOP Domain Sequences for d1xmot_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmot_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d1xmot_:

Click to download the PDB-style file with coordinates for d1xmot_.
(The format of our PDB-style files is described here.)

Timeline for d1xmot_: