SCOPe 2.02: Domain d1xmos_: 1xmo S:

Lineage for d1xmos_ (1xmo S:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
   alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123

4. Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family)

5. Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)

6. Protein Ribosomal protein S19 [54572] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
   Uniprot P80381

8. Domain d1xmos_: 1xmo S: [115518]
   Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmot_, d1xmov_
   protein/RNA complex; complexed with mg, par, zn

Details for d1xmos_

PDB Entry: 1xmo, 3.25 Å

PDB Description: Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center

PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d1xmos_:

Sequence; same for both SEQRES and ATOM records:

>d1xmos_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

Timeline for d1xmos_:

• d1xmos_ first appeared in SCOP 1.71
  
• d1xmos_ appears in SCOPe 2.01
  
• d1xmos_ appears in SCOPe 2.03
  
• d1xmos_ appears in the current release, SCOPe 2.08