SCOPe 2.03: Domain d1xmoq_: 1xmo Q:

Lineage for d1xmoq_ (1xmo Q:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein Ribosomal protein S17 [50304] (3 species)

7. Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries)
   Uniprot P24321

8. Domain d1xmoq_: 1xmo Q: [115516]
   Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmor_, d1xmos_, d1xmot_, d1xmov_
   protein/RNA complex; complexed with mg, par, zn

Details for d1xmoq_

PDB Entry: 1xmo, 3.25 Å

PDB Description: Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center

PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d1xmoq_:

Sequence; same for both SEQRES and ATOM records:

>d1xmoq_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

Timeline for d1xmoq_:

• d1xmoq_ first appeared in SCOP 1.71
  
• d1xmoq_ appears in SCOPe 2.02
  
• d1xmoq_ appears in SCOPe 2.04
  
• d1xmoq_ appears in the current release, SCOPe 2.08