| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) ![]() |
| Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit automatically mapped to Pfam PF00312 |
| Protein Ribosomal protein S15 [47065] (3 species) |
| Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries) Uniprot P80378 |
| Domain d1xmoo_: 1xmo O: [115514] Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_ protein/RNA complex; complexed with mg, par, zn |
PDB Entry: 1xmo (more details), 3.25 Å
SCOPe Domain Sequences for d1xmoo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmoo_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg
Timeline for d1xmoo_: