Lineage for d1xmoo_ (1xmo O:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697722Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2697723Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2697777Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
    automatically mapped to Pfam PF00312
  6. 2697778Protein Ribosomal protein S15 [47065] (3 species)
  7. 2697792Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
    Uniprot P80378
  8. 2697803Domain d1xmoo_: 1xmo O: [115514]
    Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_
    protein/RNA complex; complexed with mg, par, zn

Details for d1xmoo_

PDB Entry: 1xmo (more details), 3.25 Å

PDB Description: Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center
PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d1xmoo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmoo_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOPe Domain Coordinates for d1xmoo_:

Click to download the PDB-style file with coordinates for d1xmoo_.
(The format of our PDB-style files is described here.)

Timeline for d1xmoo_: