Class a: All alpha proteins [46456] (258 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension |
Protein Ribosomal protein S13 [46948] (1 species) |
Species Thermus thermophilus [TaxId:274] [46949] (36 PDB entries) |
Domain d1xmom_: 1xmo M: [115512] Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmok_, d1xmol_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_ complexed with mg, mnu, par, t6a, zn |
PDB Entry: 1xmo (more details), 3.25 Å
SCOP Domain Sequences for d1xmom_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmom_ a.156.1.1 (M:) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]} ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk kaprk
Timeline for d1xmom_: