SCOP 1.71: Domain d1xmol_: 1xmo L:

Lineage for d1xmol_ (1xmo L:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
   barrel, closed; n=5, S=8

6. Protein Ribosomal protein S12 [50302] (1 species)

7. Species Thermus thermophilus [TaxId:274] [50303] (18 PDB entries)

8. Domain d1xmol_: 1xmo L: [115511]
   Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmok_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_
   complexed with mg, mnu, par, t6a, zn

Details for d1xmol_

PDB Entry: 1xmo, 3.25 Å

PDB Description: Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center

SCOP Domain Sequences for d1xmol_:

Sequence; same for both SEQRES and ATOM records:

>d1xmol_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

Timeline for d1xmol_:

• d1xmol_ is new in SCOP 1.71
  
• d1xmol_ appears in SCOP 1.73
  
• d1xmol_ appears in the current release, SCOPe 2.08