SCOPe 2.04: Domain d1xmok_: 1xmo K:

Lineage for d1xmok_ (1xmo K:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (3 families)

5. Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)

6. Protein Ribosomal protein S11 [53141] (2 species)

7. Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries)
   Uniprot P80376

8. Domain d1xmok_: 1xmo K: [115510]
   Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_
   protein/RNA complex; complexed with mg, par, zn

Details for d1xmok_

PDB Entry: 1xmo, 3.25 Å

PDB Description: Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center

PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d1xmok_:

Sequence; same for both SEQRES and ATOM records:

>d1xmok_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

Timeline for d1xmok_:

• d1xmok_ first appeared in SCOP 1.71
  
• d1xmok_ appears in SCOPe 2.03
  
• d1xmok_ appears in SCOPe 2.05
  
• d1xmok_ appears in the current release, SCOPe 2.08