Lineage for d1xmoh_ (1xmo H:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734191Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 734192Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 734193Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 734194Protein Ribosomal protein S8 [56049] (4 species)
  7. 734212Species Thermus thermophilus [TaxId:274] [56051] (37 PDB entries)
  8. 734227Domain d1xmoh_: 1xmo H: [115507]
    Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoi_, d1xmoj_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_
    complexed with mg, mnu, par, t6a, zn

Details for d1xmoh_

PDB Entry: 1xmo (more details), 3.25 Å

PDB Description: Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center
PDB Compounds: (H:) 30S ribosomal protein S8

SCOP Domain Sequences for d1xmoh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmoh_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOP Domain Coordinates for d1xmoh_:

Click to download the PDB-style file with coordinates for d1xmoh_.
(The format of our PDB-style files is described here.)

Timeline for d1xmoh_: