SCOP 1.71: Domain d1xmog_: 1xmo G:

Lineage for d1xmog_ (1xmo G:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
   core: 5 helices; contains one more helix and a beta-hairpin outside the core

4. Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family)

5. Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)

6. Protein Ribosomal protein S7 [47975] (3 species)

7. Species Thermus thermophilus [TaxId:274] [47977] (19 PDB entries)

8. Domain d1xmog_: 1xmo G: [115506]
   Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_
   complexed with mg, mnu, par, t6a, zn

Details for d1xmog_

PDB Entry: 1xmo, 3.25 Å

PDB Description: Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center

SCOP Domain Sequences for d1xmog_:

Sequence; same for both SEQRES and ATOM records:

>d1xmog_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

Timeline for d1xmog_:

• d1xmog_ is new in SCOP 1.71
  
• d1xmog_ appears in SCOP 1.73
  
• d1xmog_ appears in the current release, SCOPe 2.08