Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.50: dsRBD-like [54767] (4 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) |
Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein) |
Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species) lacks the N-terminal helix |
Species Thermus thermophilus [TaxId:274] [54781] (18 PDB entries) |
Domain d1xmoe2: 1xmo E:5-73 [115504] Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_ complexed with mg, mnu, par, t6a, zn |
PDB Entry: 1xmo (more details), 3.25 Å
SCOP Domain Sequences for d1xmoe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmoe2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus} dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr nmvevplqn
Timeline for d1xmoe2: