Lineage for d1xmob_ (1xmo B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 579458Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 579459Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 579460Protein Ribosomal protein S2 [52315] (2 species)
  7. 579470Species Thermus thermophilus [TaxId:274] [52316] (18 PDB entries)
  8. 579482Domain d1xmob_: 1xmo B: [115499]
    Other proteins in same PDB: d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_
    complexed with mg, mnu, par, t6a, zn

Details for d1xmob_

PDB Entry: 1xmo (more details), 3.25 Å

PDB Description: Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center

SCOP Domain Sequences for d1xmob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmob_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

SCOP Domain Coordinates for d1xmob_:

Click to download the PDB-style file with coordinates for d1xmob_.
(The format of our PDB-style files is described here.)

Timeline for d1xmob_: