Lineage for d1xmda2 (1xmd A:393-610)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874558Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2874559Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2874661Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (6 proteins)
    Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains
  6. Protein Peroxisomal carnitine O-octanoyltransferase, COT, C-terminal domain [418987] (1 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [419459] (4 PDB entries)
    Uniprot Q9DC50
  8. 2874728Domain d1xmda2: 1xmd A:393-610 [115486]
    Other proteins in same PDB: d1xmda1, d1xmdb1
    complexed with epe, mpd; mutant

Details for d1xmda2

PDB Entry: 1xmd (more details), 2.1 Å

PDB Description: m335v mutant structure of mouse carnitine octanoyltransferase
PDB Compounds: (A:) Peroxisomal carnitine O-octanoyltransferase

SCOPe Domain Sequences for d1xmda2:

Sequence, based on SEQRES records: (download)

>d1xmda2 c.43.1.3 (A:393-610) Peroxisomal carnitine O-octanoyltransferase, COT, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
dlqiaastftsfgkkltkeealhpdtfiqlalqlayyrlhgrpgccyetamtryfyhgrt
etvrsctveavrwcqsmqdpsasllerqqkmleafakhnkmmkdcshgkgfdrhllglll
iakeeglpvpelfedplfsrsggggnfvlstslvgylrvqgvvvpmvhngygffyhirdd
rfvvacsswrscpetdaeklvqmifhafhdmiqlmnta

Sequence, based on observed residues (ATOM records): (download)

>d1xmda2 c.43.1.3 (A:393-610) Peroxisomal carnitine O-octanoyltransferase, COT, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
dlqiaastftlhpdtfiqlalqlayyrlhgrpgccyetamtryfyhgrtetvrsctveav
rwcqsmqdpsasllerqqkmleafakhnkmmkdcshgkgfdrhllgllliakeeglpvpe
lfedplfsrsggggnfvlstslvgylrvqgvvvpmvhngygffyhirddrfvvacsswrs
cpetdaeklvqmifhafhdmiqlmnta

SCOPe Domain Coordinates for d1xmda2:

Click to download the PDB-style file with coordinates for d1xmda2.
(The format of our PDB-style files is described here.)

Timeline for d1xmda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xmda1