Lineage for d1xmda1 (1xmd A:11-392)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1851362Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 1851363Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) (S)
  5. 1851456Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
    Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains
  6. 1851513Protein Peroxisomal carnitine O-octanoyltransferase, COT [117575] (1 species)
  7. 1851514Species Mouse (Mus musculus) [TaxId:10090] [117576] (4 PDB entries)
    Uniprot Q9DC50 11-612
  8. 1851523Domain d1xmda1: 1xmd A:11-392 [115485]
    complexed with epe, mpd; mutant

Details for d1xmda1

PDB Entry: 1xmd (more details), 2.1 Å

PDB Description: m335v mutant structure of mouse carnitine octanoyltransferase
PDB Compounds: (A:) Peroxisomal carnitine O-octanoyltransferase

SCOPe Domain Sequences for d1xmda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmda1 c.43.1.3 (A:11-392) Peroxisomal carnitine O-octanoyltransferase, COT {Mouse (Mus musculus) [TaxId: 10090]}
ertfqyqdslpslpvpaleeslkkylesvkpfanedeykkteeivqkfqegagkrlhqkl
lerargkrnwleewwlnvayldvripsqlnvnfvgpcphfehywparegtqlergsmmlw
hnlnywqllrreklpvhksgntpldmnqfrmlfstckvpgitrdsimnyfkteseghcpt
hiavlcrgrafvfdvlhegclitppellrqltyihkkcsnepvgpsiaaltseertrwak
areylisldpenltllekiqtslfvysiedssphatpeeysqvfemllggdpsvrwgdks
ynlisfangifgcccdhapydamvvvniahyvdervletegrwkgsekvrdiplpeelvf
tvdekilndvsqakaqhlkaas

SCOPe Domain Coordinates for d1xmda1:

Click to download the PDB-style file with coordinates for d1xmda1.
(The format of our PDB-style files is described here.)

Timeline for d1xmda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xmda2