Lineage for d1xmcb2 (1xmc B:393-610)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584065Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 584066Superfamily c.43.1: CoA-dependent acyltransferases [52777] (3 families) (S)
  5. 584141Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
    Pfam 00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains
  6. 584175Protein Peroxisomal carnitine O-octanoyltransferase, COT [117575] (1 species)
  7. 584176Species Mouse (Mus musculus) [TaxId:10090] [117576] (4 PDB entries)
  8. 584184Domain d1xmcb2: 1xmc B:393-610 [115484]
    complexed with epe, mpd; mutant

Details for d1xmcb2

PDB Entry: 1xmc (more details), 2 Å

PDB Description: c323m mutant structure of mouse carnitine octanoyltransferase

SCOP Domain Sequences for d1xmcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmcb2 c.43.1.3 (B:393-610) Peroxisomal carnitine O-octanoyltransferase, COT {Mouse (Mus musculus)}
dlqiaastftsfgkkltkeealhpdtfiqlalqlayyrlhgrpgccyetamtryfyhgrt
etvrsctveavrwcqsmqdpsasllerqqkmleafakhnkmmkdcshgkgfdrhllglll
iakeeglpvpelfedplfsrsggggnfvlstslvgylrvqgvvvpmvhngygffyhirdd
rfvvacsswrscpetdaeklvqmifhafhdmiqlmnta

SCOP Domain Coordinates for d1xmcb2:

Click to download the PDB-style file with coordinates for d1xmcb2.
(The format of our PDB-style files is described here.)

Timeline for d1xmcb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xmcb1