![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
![]() | Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) ![]() |
![]() | Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (6 proteins) Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains |
![]() | Domain d1xmcb2: 1xmc B:393-610 [115484] Other proteins in same PDB: d1xmca1, d1xmcb1 complexed with epe, mpd; mutant |
PDB Entry: 1xmc (more details), 2 Å
SCOPe Domain Sequences for d1xmcb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmcb2 c.43.1.3 (B:393-610) Peroxisomal carnitine O-octanoyltransferase, COT, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} dlqiaastftsfgkkltkeealhpdtfiqlalqlayyrlhgrpgccyetamtryfyhgrt etvrsctveavrwcqsmqdpsasllerqqkmleafakhnkmmkdcshgkgfdrhllglll iakeeglpvpelfedplfsrsggggnfvlstslvgylrvqgvvvpmvhngygffyhirdd rfvvacsswrscpetdaeklvqmifhafhdmiqlmnta
Timeline for d1xmcb2: