Lineage for d1xmca1 (1xmc A:11-392)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874558Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2874559Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2874661Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (6 proteins)
    Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains
  6. 2874734Protein Peroxisomal carnitine O-octanoyltransferase, COT, N-terminal domain [418986] (1 species)
  7. 2874735Species Mouse (Mus musculus) [TaxId:10090] [419458] (4 PDB entries)
    Uniprot Q9DC50
  8. 2874736Domain d1xmca1: 1xmc A:11-392 [115481]
    Other proteins in same PDB: d1xmca2, d1xmcb2
    complexed with epe, mpd; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d1xmca1

PDB Entry: 1xmc (more details), 2 Å

PDB Description: c323m mutant structure of mouse carnitine octanoyltransferase
PDB Compounds: (A:) Peroxisomal carnitine O-octanoyltransferase

SCOPe Domain Sequences for d1xmca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmca1 c.43.1.3 (A:11-392) Peroxisomal carnitine O-octanoyltransferase, COT, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
ertfqyqdslpslpvpaleeslkkylesvkpfanedeykkteeivqkfqegagkrlhqkl
lerargkrnwleewwlnvayldvripsqlnvnfvgpcphfehywparegtqlergsmmlw
hnlnywqllrreklpvhksgntpldmnqfrmlfstckvpgitrdsimnyfkteseghcpt
hiavlcrgrafvfdvlhegclitppellrqltyihkkcsnepvgpsiaaltseertrwak
areylisldpenltllekiqtslfvysiedssphatpeeysqvfemllggdpsvrwgdks
ynlisfangifgmccdhapydamvmvniahyvdervletegrwkgsekvrdiplpeelvf
tvdekilndvsqakaqhlkaas

SCOPe Domain Coordinates for d1xmca1:

Click to download the PDB-style file with coordinates for d1xmca1.
(The format of our PDB-style files is described here.)

Timeline for d1xmca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xmca2