Lineage for d1xmaa_ (1xma A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762914Family a.4.5.61: PadR-like [116807] (3 proteins)
    Pfam PF03551; related to the MarR-like family (Pfam PF01047)
  6. 762921Protein Predicted transcriptional regulator [116808] (1 species)
    monomeric
  7. 762922Species Clostridium thermocellum [TaxId:1515] [116809] (1 PDB entry)
    Uniprot Q4CEJ8 4-106
  8. 762923Domain d1xmaa_: 1xma A: [115477]

Details for d1xmaa_

PDB Entry: 1xma (more details), 2.3 Å

PDB Description: structure of a transcriptional regulator from clostridium thermocellum cth-833
PDB Compounds: (A:) Predicted transcriptional regulator

SCOP Domain Sequences for d1xmaa_:

Sequence, based on SEQRES records: (download)

>d1xmaa_ a.4.5.61 (A:) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]}
sdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngyiks
yygeetqgkrrtyyritpegikyykqkceeweltkkvinkfvk

Sequence, based on observed residues (ATOM records): (download)

>d1xmaa_ a.4.5.61 (A:) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]}
sdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngyiks
yygeetkrrtyyritpegikyykqkceeweltkkvinkfvk

SCOP Domain Coordinates for d1xmaa_:

Click to download the PDB-style file with coordinates for d1xmaa_.
(The format of our PDB-style files is described here.)

Timeline for d1xmaa_: