SCOP 1.71: Domain d1xmaa_: 1xma A:

Lineage for d1xmaa_ (1xma A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.61: PadR-like [116807] (2 proteins)
   Pfam 03551; related to the MarR-like family (Pfam 01047)

6. Protein Predicted transcriptional regulator [116808] (1 species)
   monomeric

7. Species Clostridium thermocellum [TaxId:1515] [116809] (1 PDB entry)

8. Domain d1xmaa_: 1xma A: [115477]

Details for d1xmaa_

PDB Entry: 1xma, 2.3 Å

PDB Description: structure of a transcriptional regulator from clostridium thermocellum cth-833

SCOP Domain Sequences for d1xmaa_:

Sequence, based on SEQRES records:

>d1xmaa_ a.4.5.61 (A:) Predicted transcriptional regulator {Clostridium thermocellum}
sdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngyiks
yygeetqgkrrtyyritpegikyykqkceeweltkkvinkfvk

Sequence, based on observed residues (ATOM records):

>d1xmaa_ a.4.5.61 (A:) Predicted transcriptional regulator {Clostridium thermocellum}
sdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngyiks
yygeetkrrtyyritpegikyykqkceeweltkkvinkfvk

Timeline for d1xmaa_:

• d1xmaa_ is new in SCOP 1.71
  
• d1xmaa_ appears in SCOP 1.73
  
• d1xmaa_ appears in the current release, SCOPe 2.08