Lineage for d1xm8a_ (1xm8 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1937671Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1937672Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1937904Family d.157.1.2: Glyoxalase II (hydroxyacylglutathione hydrolase) [56288] (1 protein)
  6. 1937905Protein Glyoxalase II (hydroxyacylglutathione hydrolase) [56289] (3 species)
  7. 1937913Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118145] (2 PDB entries)
    Uniprot Q9SID3
  8. 1937914Domain d1xm8a_: 1xm8 A: [115475]
    Structural genomics target
    complexed with acy, fe, peg, zn

Details for d1xm8a_

PDB Entry: 1xm8 (more details), 1.74 Å

PDB Description: x-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350
PDB Compounds: (A:) glyoxalase II

SCOPe Domain Sequences for d1xm8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xm8a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mqielvpclkdnyayilhdedtgtvgvvdpseaepiidslkrsgrnltyilnthhhydht
ggnlelkdrygakvigsamdkdripgidmalkdgdkwmfaghevhvmdtpghtkghisly
fpgsraiftgdtmfslscgklfegtpkqmlaslqkitslpddtsiycgheytlsnskfal
slepnnevlqsyaahvaelrskklptipttvkmekacnpflrssntdirralripeaade
aealgiirkakddf

SCOPe Domain Coordinates for d1xm8a_:

Click to download the PDB-style file with coordinates for d1xm8a_.
(The format of our PDB-style files is described here.)

Timeline for d1xm8a_: