Lineage for d1xm7b_ (1xm7 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440476Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1440477Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1440725Family d.159.1.8: Hypothetical protein aq_1666 [118152] (1 protein)
  6. 1440726Protein Hypothetical protein aq_1666 [118153] (1 species)
  7. 1440727Species Aquifex aeolicus [TaxId:63363] [118154] (1 PDB entry)
    Uniprot O67582
  8. 1440729Domain d1xm7b_: 1xm7 B: [115474]
    Structural genomics target

Details for d1xm7b_

PDB Entry: 1xm7 (more details), 2.4 Å

PDB Description: The Crystal Structure of the Protein of Unknown Function AQ665 from Aquifex aeolicus
PDB Compounds: (B:) hypothetical protein aq_1665

SCOPe Domain Sequences for d1xm7b_:

Sequence, based on SEQRES records: (download)

>d1xm7b_ d.159.1.8 (B:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]}
nammyfisdthfyheniinlnpevrfkgfeiviltnllkvlkpedtlyhlgdftwhfndk
neylriwkalpgrkilvmgnhdkdkeslkeyfdeiydfykiiehkgkrillshypakdpi
terypdrqemvreiyfkencdllihghvhwnregikcackdyriecinanvewndykpis
ereidkli

Sequence, based on observed residues (ATOM records): (download)

>d1xm7b_ d.159.1.8 (B:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]}
nammyfisdthfyheniinlnpevrfkgfeiviltnllkvlkpedtlyhlgdftwhfndk
neylriwkalpgrkilvmgnhdkdkeslkeyfdeiydfykiiehkgkrillshypakdpi
terypdrqemvreiyfkencdllihghvhwnregcackdyriecinanvewndykpiser
eidkli

SCOPe Domain Coordinates for d1xm7b_:

Click to download the PDB-style file with coordinates for d1xm7b_.
(The format of our PDB-style files is described here.)

Timeline for d1xm7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xm7a_