SCOP 1.71: Domain d1xm7b_: 1xm7 B:

Lineage for d1xm7b_ (1xm7 B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (9 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam 00149

5. Family d.159.1.8: Hypothetical protein aq 1666 [118152] (1 protein)

6. Protein Hypothetical protein aq_1666 [118153] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [118154] (1 PDB entry)

8. Domain d1xm7b_: 1xm7 B: [115474]
   Structural genomics target

Details for d1xm7b_

PDB Entry: 1xm7, 2.4 Å

PDB Description: The Crystal Structure of the Protein of Unknown Function AQ665 from Aquifex aeolicus

SCOP Domain Sequences for d1xm7b_:

Sequence, based on SEQRES records:

>d1xm7b_ d.159.1.8 (B:) Hypothetical protein aq_1666 {Aquifex aeolicus}
nammyfisdthfyheniinlnpevrfkgfeiviltnllkvlkpedtlyhlgdftwhfndk
neylriwkalpgrkilvmgnhdkdkeslkeyfdeiydfykiiehkgkrillshypakdpi
terypdrqemvreiyfkencdllihghvhwnregikcackdyriecinanvewndykpis
ereidkli

Sequence, based on observed residues (ATOM records):

>d1xm7b_ d.159.1.8 (B:) Hypothetical protein aq_1666 {Aquifex aeolicus}
nammyfisdthfyheniinlnpevrfkgfeiviltnllkvlkpedtlyhlgdftwhfndk
neylriwkalpgrkilvmgnhdkdkeslkeyfdeiydfykiiehkgkrillshypakdpi
terypdrqemvreiyfkencdllihghvhwnregcackdyriecinanvewndykpiser
eidkli

Timeline for d1xm7b_:

• d1xm7b_ is new in SCOP 1.71
  
• d1xm7b_ appears in SCOP 1.73
  
• d1xm7b_ appears in the current release, SCOPe 2.08, called d1xm7b1