![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.8: Hypothetical protein aq_1666 [118152] (1 protein) |
![]() | Protein Hypothetical protein aq_1666 [118153] (1 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [118154] (1 PDB entry) Uniprot O67582 |
![]() | Domain d1xm7b1: 1xm7 B:1-186 [115474] Other proteins in same PDB: d1xm7a2, d1xm7b2 Structural genomics target |
PDB Entry: 1xm7 (more details), 2.4 Å
SCOPe Domain Sequences for d1xm7b1:
Sequence, based on SEQRES records: (download)
>d1xm7b1 d.159.1.8 (B:1-186) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} mmyfisdthfyheniinlnpevrfkgfeiviltnllkvlkpedtlyhlgdftwhfndkne ylriwkalpgrkilvmgnhdkdkeslkeyfdeiydfykiiehkgkrillshypakdpite rypdrqemvreiyfkencdllihghvhwnregikcackdyriecinanvewndykpiser eidkli
>d1xm7b1 d.159.1.8 (B:1-186) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} mmyfisdthfyheniinlnpevrfkgfeiviltnllkvlkpedtlyhlgdftwhfndkne ylriwkalpgrkilvmgnhdkdkeslkeyfdeiydfykiiehkgkrillshypakdpite rypdrqemvreiyfkencdllihghvhwnregcackdyriecinanvewndykpiserei dkli
Timeline for d1xm7b1: