SCOP 1.73: Domain d1xm7a_: 1xm7 A:

Lineage for d1xm7a_ (1xm7 A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (10 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.8: Hypothetical protein aq 1666 [118152] (1 protein)

6. Protein Hypothetical protein aq_1666 [118153] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [118154] (1 PDB entry)

8. Domain d1xm7a_: 1xm7 A: [115473]

Details for d1xm7a_

PDB Entry: 1xm7, 2.4 Å

PDB Description: The Crystal Structure of the Protein of Unknown Function AQ665 from Aquifex aeolicus

PDB Compounds: (A:) hypothetical protein aq_1665

SCOP Domain Sequences for d1xm7a_:

Sequence, based on SEQRES records:

>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]}
nammyfisdthfyheniinlnpevrfkgfeiviltnllkvlkpedtlyhlgdftwhfndk
neylriwkalpgrkilvmgnhdkdkeslkeyfdeiydfykiiehkgkrillshypakdpi
terypdrqemvreiyfkencdllihghvhwnregikcackdyriecinanvewndykpis
ereidkli

Sequence, based on observed residues (ATOM records):

>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]}
nammyfisdthfyheniinlnpevrfkgfeiviltnllkvlkpedtlyhlgdftwhfndk
neylriwkalpgrkilvmgnhdkdkeslkeyfdeiydfykiiehkgkrillshypakdpi
terypdrqemvreiyfkencdllihghvhwnregcackdyriecinanvewndykpiser
eidkli

Timeline for d1xm7a_:

• d1xm7a_ first appeared in SCOP 1.71
  
• d1xm7a_ appears in SCOP 1.75
  
• d1xm7a_ appears in the current release, SCOPe 2.08, called d1xm7a1