SCOPe 2.08: Domain d1xm7a1: 1xm7 A:1-186

Lineage for d1xm7a1 (1xm7 A:1-186)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.8: Hypothetical protein aq_1666 [118152] (1 protein)

6. Protein Hypothetical protein aq_1666 [118153] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [118154] (1 PDB entry)
   Uniprot O67582

8. Domain d1xm7a1: 1xm7 A:1-186 [115473]
   Other proteins in same PDB: d1xm7a2, d1xm7b2
   Structural genomics target

Details for d1xm7a1

PDB Entry: 1xm7, 2.4 Å

PDB Description: The Crystal Structure of the Protein of Unknown Function AQ665 from Aquifex aeolicus

PDB Compounds: (A:) hypothetical protein aq_1665

SCOPe Domain Sequences for d1xm7a1:

Sequence, based on SEQRES records:

>d1xm7a1 d.159.1.8 (A:1-186) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]}
mmyfisdthfyheniinlnpevrfkgfeiviltnllkvlkpedtlyhlgdftwhfndkne
ylriwkalpgrkilvmgnhdkdkeslkeyfdeiydfykiiehkgkrillshypakdpite
rypdrqemvreiyfkencdllihghvhwnregikcackdyriecinanvewndykpiser
eidkli

Sequence, based on observed residues (ATOM records):

>d1xm7a1 d.159.1.8 (A:1-186) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]}
mmyfisdthfyheniinlnpevrfkgfeiviltnllkvlkpedtlyhlgdftwhfndkne
ylriwkalpgrkilvmgnhdkdkeslkeyfdeiydfykiiehkgkrillshypakdpite
rypdrqemvreiyfkencdllihghvhwnregcackdyriecinanvewndykpiserei
dkli

Timeline for d1xm7a1:

• d1xm7a1 first appeared in SCOP 1.71, called d1xm7a_
  
• d1xm7a1 appears in SCOPe 2.07