Lineage for d1xm6a_ (1xm6 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780219Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 780220Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) (S)
  5. 780284Family a.211.1.2: PDEase [48548] (6 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 780288Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)
  7. 780289Species Human (Homo sapiens) [TaxId:9606] [48550] (14 PDB entries)
    Uniprot Q07343 324-667
  8. 780292Domain d1xm6a_: 1xm6 A: [115471]

Details for d1xm6a_

PDB Entry: 1xm6 (more details), 1.92 Å

PDB Description: Catalytic Domain Of Human Phosphodiesterase 4B In Complex With (R)-Mesopram
PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOP Domain Sequences for d1xm6a_:

Sequence, based on SEQRES records: (download)

>d1xm6a_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
qpdaqdildtlednrnwyqsmipqspsppldeqnrdcqglmekfqfeltld

Sequence, based on observed residues (ATOM records): (download)

>d1xm6a_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
qpdaqdildtlednrnwyqsmipcqglmekfqfeltld

SCOP Domain Coordinates for d1xm6a_:

Click to download the PDB-style file with coordinates for d1xm6a_.
(The format of our PDB-style files is described here.)

Timeline for d1xm6a_: