Lineage for d1xm5a_ (1xm5 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607530Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 607531Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 607971Family d.92.1.15: Predicted metal-dependent hydrolase [103132] (3 proteins)
    Pfam 02130; UPF0054; COG0319; MMP-like fold with a different sequence motif in the putative active site
  6. 607978Protein Hypothetical protein YbeY [118048] (1 species)
  7. 607979Species Escherichia coli [TaxId:562] [118049] (1 PDB entry)
  8. 607980Domain d1xm5a_: 1xm5 A: [115467]

Details for d1xm5a_

PDB Entry: 1xm5 (more details), 2.7 Å

PDB Description: crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054

SCOP Domain Sequences for d1xm5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xm5a_ d.92.1.15 (A:) Hypothetical protein YbeY {Escherichia coli}
msqvildlqlacednsglpeesqfqtwlnavipqfqeesevtirvvdtaeshslnltyrg
kdkptnvlsfpfevppgmemsllgdlvicrqvvekeaqeqgkpleahwahmvvhgslhll
gydhieddeaeemealeteimlalgyedpyia

SCOP Domain Coordinates for d1xm5a_:

Click to download the PDB-style file with coordinates for d1xm5a_.
(The format of our PDB-style files is described here.)

Timeline for d1xm5a_: